TP53

 
Hsap
MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPS...QAMDDLMLSP
Mmul
MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPS...QAVDDLMLSP
Btau
MEESQAELNVEPPLSQETFSDLWNLLPENNLLSSELS...APVDDLLP.Y
Cfam
MEESQSELNIDPPLSQETFSELWNLLPENNVLSSELC...PAVDELLL.P
Mmus
MEESQSDISLELPLSQETFSGLWKLLPPEDILP.....SPHCMDDLLL.P
Rnor
MEDSQSDMSIELPLSQETFSCLWKLLPPDDILPTTATGSPNSMEDLFL.P
Ggal
MAEEMEPL.LEP...TEVFMDLWSMLP.............YSMQQLPL.P
Xlav
M.EPSSETGMDPPLSQETFEDLWSLLP.............DPLQTVTCRL
Drer
MAQND.........SQE.FAELW...................EKNLIIQP
 
DDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAPAPAPSWPLSSSV
DDLAQWLTEDPGPDEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSV
TDVATWLDECP..NEAPQMPEPS.....APAAPPPATPAPATSWPLSSFV
ESVVNWLDEDS..DDAPRMPATS.....APTAP.....GPAPSWPLSSSV
QDVEEFFE...GPSEALRVSGAPAAQDPVTETPGPVAPAPATPWPLSSFV
QDVAELLE...GPEEALQVS.APAAQEPGTEAPAPVAPASATPWPLSSSV
EDHSNWQELSPLEPSDPPPPPPPPPLPLAAAAPPPLNPPTPPRAAPSPVV
DNLSEFP.......DYPLAADMT........VLQEGLMGNAVPTVTSCAV
PGGGSCWDIINDEEYLPGSFDPN......FFENVLEEQPQPSTLPPTSTV
 
PSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWV
PSQKTYHGSYGFRLGFLHSGTAKSVTCTYSPDLNKMFCQLAKTCPVQLWV
PSQKTYPGNYGFRLGFLQSGTAKSVTCTYSPSLNKLFCQLAKTCPVQLWV
PSPKTYPGTYGFRLGFLHSGTAKSVTWTYSPLLNKLFCQLAKTCPVQLWV
PSQKTYQGNYGFHLGFLQSGTAKSVMCTYSPPLNKLFCQLAKTCPVQLWV
PSQKTYQGNYGFHLGFLQSGTAKSVMCTYSISLNKLFCQLAKTCPVQLWV
PSTEDYGGDFDFRVGFVEAGTAKSVTCTYSPVLNKVYCRLAKPCPVQVRV
PSTDDYAGKYGLQLDFQQNGTAKSVTCTYSPELNKLFCQLAKTCPLLVRV
PETSDYPGDHGFRLRFPQSGTAKSVTCTYSPDLNKLFCQLAKTCPVQMVV
 
DSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSD.SDGLAPPQHLIR
DSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHERCSD.SDGLAPPQHLIR
DSPPPPGTRVRAMAIYKKLEHMTEVVRRCPHHERSSDYSDGLAPPQHLIR
SSPPPPNTCVRAMAIYKKSEFVTEVVRRCPHHERCSDSSDGLAPPQHLIR
SATPPAGSRVRAMAIYKKSQHMTEVVRRCPHHERCSD.GDGLAPPQHLIR
TSTPPPGTRVRAMAIYKKSQHMTEVVRRCPHHERCSD.GDGLAPPQHLIR
GVAPPPGSSLRAVAVYKKSEHVAEVVRRCPHHERCGGGTDGLAPAQHLIR
ESPPPRGSILRATAVYKKSEHVAEVVKRCPHHERSVEPGEDAAPPSHLMR
DVAPPQGSVVRATAIYKKSEHVAEVVRRCPHHERTPD.GDNLAPAGHLIR
 
VEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGM
VEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGM
VEGNLRAEYLDDRNTFRHSVVVPYESPEIDSECTTIHYNFMCNSSCMGGM
VEGNLRAKYLDDRNTFRHSVVVPYEPPEVGSDYTTIHYNYMCNSSCMGGM
VEGNLYPEYLEDRQTFRHSVVVPYEPPEAGSEYTTIHYKYMCNSSCMGGM
VEGNPYAEYLDDRQTFRHSVVVPYEPPEVGSDYTTIHYKYMCNSSCMGGM
VEGNPQARYHDDETTKRHSVVVPYEPPEVGSDCTTVLYNFMCNSSCMGGM
VEGNLQAYYMEDVNSGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCMGGM
VEGNQRANYREDNITLRHSVFVPYEAPQLGAEWTTVLLNYMCNSSCMGGM
 
NRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGEPH
NRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPC
NRRPILTIITLEDSCGNLLGRNSFEVRVCACPGRDRRTEEENLRKKGQSC
NRRPILTIITLEDSSGNVLGRNSFEVRVCACPGRDRRTEEENFHKKGEPC
NRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLC
NRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEEHC
NRRPILTILTLEGPGGQLLGRRCFEVRVCACPGRDRKIEEENFRKRGGAG
NRRPILTIITLETPQGLLLGRRCFEVRVCACPGRDRRTEEDNYTKKRGLK
NRRPILTIITLETQEGQLLGRRSFEVRVCACPGRDRKTEESNFKKDQETK
 
HELPPGS.TKRALPNNTSSS.....PQPKKKPL..DGEYFTLQIRGRERF
HQLPPGS.TKRALPNNTSSS.....PQPKKKPL..DGEYFTLQIRGRERF
PEPPPRS.TKRALPTNTSSS.....PQPKKKPL..DGEYFTLQIRGFKRY
PEPPPGS.TKRALPPSTSSS.....PPQKKKPL..DGEYFTLQIRGRERY
PELPPGS.AKRALPTCTSAS.....PPQKKKPL..DGEYFTLKIRGRKRF
PELPPGS.AKRALPTSTSSS.....PQQKKKPL..DGEYFTLKIRGRERF
.....GV.AKRAMSPPTEAP.....EPPKKRVLNPDNEIFYLQVRGRRRY
.....PS.GKRELAHPPSSE...PPLPKKRLVVDDDEEIFTLRIKGRSRY
TMAKTTTGTKRSLVKESSSATLRPEGSKKAKGSSSDEEIFTLQVRGRERY
 
EMFRELNEALELKDAQAGKE.PGGSRAHSSHLKSKKGQSTS...RHKKLM
EMFRELNEALELKDAQAGKE.PAGSRAHSSHLKSKKGQSTS...RHKKFM
EMFRELNDALELKDALDGRE.PGESRAHSSHLKSKKRPSPS...CHKKPM
EMFRNLNEALELKDAQSGKE.PGGSRAHSSHLKAKKGQSTS...RHKKLM
EMFRELNEALELKDAHATEE.SGDSRAHSSYLKTKKGQSTS...RHKKTM
EMFRELNEALELKDARAAEE.SGDSRAHSSYPKTKKGQSTS...RHKKPM
EMLKEINEALQLAEGGSAPR.PSKGRR....VKV.EGPQPS...CGKKLL
EMIKKLNDALELQESLDQQKVTIKCRKCRDEIKPK.........KGKKLL
EILKKLNDSLELSDVVPASD.AEKYRQKFMTKNKKENRESSEPKQGKKLM
 
FKTEG.PDSD
FKTEG.PDSD
LKREG.PDSD
FKREG.LDSD
VKKVG.PDSD
IKKVG.PDSD
QK..G.SD
VKDEQ.PDSE
VKDEGRSDSD
If you see this text, then Java-Script did not work

Recommended browser: Google Chrome
Supported browsers: Google Chrome, Firefox, Opera, Safari.
Not supported: Internet Explorer

License: This Sequence alignment export can be modified and used in Web pages for free, but this text and the links to the project must not be removed.

Exported by Alignment program Alignments in Web pages